evdenevenakliyatcifirmalari.com
Free website and domain report on evdenevenakliyatcifirmalari.com
Last Updated: 7th June, 2020 Update Now
Overview
Snoop Summary for evdenevenakliyatcifirmalari.com
This is a free and comprehensive report about evdenevenakliyatcifirmalari.com. The domain evdenevenakliyatcifirmalari.com is currently hosted on a server located in Dallas, Texas in United States with the IP address 198.252.98.54, where USD is the local currency and the local language is English. This report was last updated 7th June, 2020.
About evdenevenakliyatcifirmalari.com
Site Preview: | |
Title: | www.evdenevenakliyatcifirmalari.com – Welcome to evdenevenakliyatcifirmalari.com |
Description: | |
Keywords and Tags: | marketing, merchandising |
Related Terms: | |
Fav Icon: | |
Age: | Over 4 years old |
Domain Created: | 6th August, 2019 |
Domain Updated: | 1st June, 2020 |
Domain Expires: | 6th August, 2020 |
Review
Snoop Score
Valuation
Popularity
Rank, Reach and Authority
Alexa Rank: | |
Alexa Reach: | |
SEMrush Rank (US): | |
SEMrush Authority Score: | |
Moz Domain Authority: | |
Moz Page Authority: |
Organic vs Paid (Google Ads)
Traffic
Visitors
Daily Visitors: | |
Monthly Visitors: | |
Yearly Visitors: |
Note: All visitors figures are estimates.
Visitors By Country
Revenue
Revenue
Daily Revenue: | |
Monthly Revenue: | |
Yearly Revenue: |
Note: All revenue figures are estimates.
Revenue By Country
SEO
Backlinks Analysis (SEMrush)
Top New Follow Links
Top Ranking Keywords (US)
Domain Analysis
Value | Length | |
---|---|---|
Domain: | evdenevenakliyatcifirmalari.com | 31 |
Domain Name: | evdenevenakliyatcifirmalari | 27 |
Extension (TLD): | com | 3 |
Expiry Check: | |
Page Speed Analysis
Average Load Time: | |
Load Time Comparison: |
PageSpeed Insights
Hosting
Server Location
Server IP Address: | 198.252.98.54 |
Continent: | North America |
Country: | United States |
Region: | Texas |
City: | Dallas |
Longitude: | -96.8703 |
Latitude: | 32.8152 |
Currencies: | USD USN USS |
Languages: | English |
Web Hosting Provider
Name | IP Address |
---|---|
Hawk Host Inc. |
Registration
Domain Registrant
Private Registration: | No |
Name: | |
Organization: |
Country: | |
City: | |
State: | |
Post Code: | |
Email: | |
Phone: |
Note: Registration information is derived from various sources and may be inaccurate.
Domain Registrar
Name | IP Address |
---|---|
NameSilo, LLC | 104.18.30.76 |
Security
Visitor Safety
Mature Content: | Not Likely |
McAfee WebAdvisor Rating: | Safe |
WOT Rating: | |
WOT Trustworthiness: | |
WOT Child Safety: |
Note: Safety information is not guaranteed.
SSL/TLS Certificate
Issued To: | cpcontacts.evdenevenakliyatcifirmalari.com |
Issued By: | Let's Encrypt Authority X3 |
Valid From: | 6th May, 2020 |
Valid To: | 4th August, 2020 |
Subject: | CN = cpcontacts.evdenevenakliyatcifirmalari.com |
Hash: | 994c24bc |
Issuer: | CN = Let's Encrypt Authority X3 O = Let's Encrypt S = US |
Version: | 2 |
Serial Number: | 0x0456772656B6179ADB7940A5C869630EEC37 |
Serial Number (Hex): | 0456772656B6179ADB7940A5C869630EEC37 |
Valid From: | 6th May, 2024 |
Valid To: | 4th August, 2024 |
Signature Algorithm (Short Name): | RSA-SHA256 |
Signature Algorithm (Long Name): | sha256WithRSAEncryption |
Authority Key Identifier: | keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1 |
Extended Key Usage: | TLS Web Server Authentication, TLS Web Client Authentication |
Certificate Policies: | Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org |
Authority Information Access: | OCSP - URI:http://ocsp.int-x3.letsencrypt.org CA Issuers - URI:http://cert.int-x3.letsencrypt.org/ |
SCT List: | Signed Certificate Timestamp: Version : v1 (0x0) Log ID : F0:95:A4:59:F2:00:D1:82:40:10:2D:2F:93:88:8E:AD: 4B:FE:1D:47:E3:99:E1:D0:34:A6:B0:A8:AA:8E:B2:73 Timestamp : May 6 11:09:14.212 2020 GMT Extensions: none Signature : ecdsa-with-SHA256 30:45:02:20:07:BB:B6:2E:33:5C:36:4D:82:19:F4:2D: 4C:E6:31:F2:F9:01:B6:90:9D:DB:7D:0A:58:73:FB:2F: 55:12:F5:8B:02:21:00:A0:85:AF:FF:7C:1F:32:75:2C: B9:9C:4E:46:CB:89:A1:25:C2:42:25:1C:9F:3C:80:B2: A6:8D:F6:A2:3B:BC:EE Signed Certificate Timestamp: Version : v1 (0x0) Log ID : 07:B7:5C:1B:E5:7D:68:FF:F1:B0:C6:1D:23:15:C7:BA: E6:57:7C:57:94:B7:6A:EE:BC:61:3A:1A:69:D3:A2:1C Timestamp : May 6 11:09:14.276 2020 GMT Extensions: none Signature : ecdsa-with-SHA256 30:44:02:20:4B:8C:F8:90:0F:30:46:D6:D4:27:79:A5: 16:F2:70:FE:34:16:BB:E8:12:1F:76:6F:73:FF:76:F1: 75:22:22:6A:02:20:57:A5:A4:D2:EC:F0:78:19:6F:9F: 6B:09:AC:D9:A0:76:F9:26:AA:AA:26:40:81:4B:49:1B: 99:DF:DD:9C:57:77 |
Key Usage: | Digital Signature, Key Encipherment |
Basic Constraints: | CA:FALSE |
Subject Alternative Name: | DNS:cpanel.2016riskcom.net DNS:cpanel.evdenevenakliyatcifirmalari.com DNS:cpcalendars.2016riskcom.net DNS:cpcalendars.evdenevenakliyatcifirmalari.com DNS:cpcontacts.2016riskcom.net DNS:cpcontacts.evdenevenakliyatcifirmalari.com DNS:evdenevenakliyatcifirmalari.2016riskcom.net DNS:evdenevenakliyatcifirmalari.com DNS:kabarsatunews.2016riskcom.net DNS:mail.2016riskcom.net DNS:mail.evdenevenakliyatcifirmalari.com DNS:pentruviata.2016riskcom.net DNS:thebikechurch.2016riskcom.net DNS:webdisk.2016riskcom.net DNS:webdisk.evdenevenakliyatcifirmalari.com DNS:webmail.2016riskcom.net DNS:webmail.evdenevenakliyatcifirmalari.com DNS:www.2016riskcom.net DNS:www.evdenevenakliyatcifirmalari.2016riskcom.net DNS:www.evdenevenakliyatcifirmalari.com DNS:www.kabarsatunews.2016riskcom.net DNS:www.pentruviata.2016riskcom.net DNS:www.thebikechurch.2016riskcom.net DNS:2016riskcom.net |
Technical
DNS Lookup
A Records
Host | IP Address | Class | TTL |
---|---|---|---|
evdenevenakliyatcifirmalari.com. | 198.252.98.54 | IN | 14399 |
NS Records
Host | Nameserver | Class | TTL |
---|---|---|---|
evdenevenakliyatcifirmalari.com. | ns6.hawkhost.com. | IN | 21599 |
evdenevenakliyatcifirmalari.com. | ns5.hawkhost.com. | IN | 21599 |
MX Records
Priority | Host | Server | Class | TTL |
---|---|---|---|---|
0 | evdenevenakliyatcifirmalari.com. | evdenevenakliyatcifirmalari.com. | IN | 14399 |
SOA Records
Domain Name | Primary NS | Responsible Email | TTL |
---|---|---|---|
evdenevenakliyatcifirmalari.com. | ns5.hawkhost.com. | server.hawkhost.com. | 21599 |
TXT Records
Host | Value | Class | TTL |
---|---|---|---|
evdenevenakliyatcifirmalari.com. | v=spf1 | IN | 14399 |
HTTP Response Headers
HTTP-Code: | HTTP/1.1 200 OK |
Content-Type: | text/html; charset=UTF-8 |
Date: | 7th June, 2020 |
Server: | LiteSpeed |
Connection: | Keep-Alive |
X-Powered-By: | PHP/7.3.18 |
Link: | <http://www.evdenevenakliyatcifirmalari.com/wp-json/>; rel="https://api.w.org/" |
Etag: | "22490-1591258885;;;" |
X-LiteSpeed-Cache: | hit |
Whois Lookup
Created: | 6th August, 2019 |
Changed: | 1st June, 2020 |
Expires: | 6th August, 2020 |
Registrar: | NameSilo, LLC |
Status: | clientTransferProhibited |
Nameservers: | ns5.hawkhost.com ns6.hawkhost.com |
Owner Name: | Domain Administrator |
Owner Organization: | See PrivacyGuardian.org |
Owner Street: | 1928 E. Highland Ave. Ste F104 PMB# 255 |
Owner Post Code: | 85016 |
Owner City: | Phoenix |
Owner State: | AZ |
Owner Country: | US |
Owner Phone: | +1.3478717726 |
Owner Email: | pw-4320c1ad6b2a934ac41d799fdf5245bd@privacyguardian.org |
Admin Name: | Domain Administrator |
Admin Organization: | See PrivacyGuardian.org |
Admin Street: | 1928 E. Highland Ave. Ste F104 PMB# 255 |
Admin Post Code: | 85016 |
Admin City: | Phoenix |
Admin State: | AZ |
Admin Country: | US |
Admin Phone: | +1.3478717726 |
Admin Email: | pw-4320c1ad6b2a934ac41d799fdf5245bd@privacyguardian.org |
Tech Name: | Domain Administrator |
Tech Organization: | See PrivacyGuardian.org |
Tech Street: | 1928 E. Highland Ave. Ste F104 PMB# 255 |
Tech Post Code: | 85016 |
Tech City: | Phoenix |
Tech State: | AZ |
Tech Country: | US |
Tech Phone: | +1.3478717726 |
Tech Email: | pw-4320c1ad6b2a934ac41d799fdf5245bd@privacyguardian.org |
Full Whois: | Domain Name: evdenevenakliyatcifirmalari.com Registry Domain ID: 2420767273_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.namesilo.com Registrar URL: https://www.namesilo.com/ Updated Date: 2020-06-01T07:00:00Z Creation Date: 2019-08-06T07:00:00Z Registrar Registration Expiration Date: 2020-08-06T07:00:00Z Registrar: NameSilo, LLC Registrar IANA ID: 1479 Registrar Abuse Contact Email: abuse@namesilo.com Registrar Abuse Contact Phone: +1.4805240066 Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: Domain Administrator Registrant Organization: See PrivacyGuardian.org Registrant Street: 1928 E. Highland Ave. Ste F104 PMB# 255 Registrant City: Phoenix Registrant State/Province: AZ Registrant Postal Code: 85016 Registrant Country: US Registrant Phone: +1.3478717726 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: pw-4320c1ad6b2a934ac41d799fdf5245bd@privacyguardian.org Registry Admin ID: Admin Name: Domain Administrator Admin Organization: See PrivacyGuardian.org Admin Street: 1928 E. Highland Ave. Ste F104 PMB# 255 Admin City: Phoenix Admin State/Province: AZ Admin Postal Code: 85016 Admin Country: US Admin Phone: +1.3478717726 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: pw-4320c1ad6b2a934ac41d799fdf5245bd@privacyguardian.org Registry Tech ID: Tech Name: Domain Administrator Tech Organization: See PrivacyGuardian.org Tech Street: 1928 E. Highland Ave. Ste F104 PMB# 255 Tech City: Phoenix Tech State/Province: AZ Tech Postal Code: 85016 Tech Country: US Tech Phone: +1.3478717726 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: pw-4320c1ad6b2a934ac41d799fdf5245bd@privacyguardian.org Name Server: ns5.hawkhost.com Name Server: ns6.hawkhost.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-06-06T07:00:00Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE AND TERMS OF USE: You are not authorized to access or query our WHOIS database through the use of high-volume, automated, electronic processes. The Data in our WHOIS database is provided for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. We do not guarantee its accuracy. By submitting a WHOIS query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to us (or our computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without our prior written consent. We reserve the right to terminate your access to the WHOIS database at our sole discretion, including without limitation, for excessive querying of the WHOIS database or for failure to otherwise abide by this policy. We reserve the right to modify these terms at any time. Domains - cheap, easy, and secure at NameSilo.com https://www.namesilo.com Register your domain now at www.NameSilo.com - Domains. Cheap, Fast and Secure |
Nameservers
Name | IP Address |
---|---|
ns5.hawkhost.com | 198.252.96.120 |
ns6.hawkhost.com | 198.252.97.120 |
Love W3 Snoop?